PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00063821001
Common NameGSBRNA2T00063821001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 201aa    MW: 21517.9 Da    PI: 9.7767
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00063821001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-392584362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +++l+cprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  GSBRNA2T00063821001 25 QEQLNCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGTRKNAKRS 84
                         7899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.9E-332682IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-252883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3112882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKQQQQQP QFPVQEQLNC PRCDSPNTKF CYYNNYNLSQ PRHFCKSCRR  60
YWTKGGALRN VPVGGGTRKN AKRSTSSPTS PSNNKKTKNT DPDPNSQTGN KPDTDPTRML  120
YGFPIGDQDV KGMEMGGGGG SFSSLLASNM QLGLGGIILD GSGWDPGMGL RRSEAGNGGG  180
GGGGGGNPWT NLALNRVEKN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.208800.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00063821001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893440.0AC189344.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042J11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109674.11e-145PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotQ94AR69e-86DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLA0A078HIY31e-146A0A078HIY3_BRANA; BnaA01g25190D protein
STRINGBra023888.1-P1e-145(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.13e-66DOF zinc finger protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]